PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG021629t1
Common NameTCM_021629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 201aa    MW: 23249.6 Da    PI: 9.6459
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG021629t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.46.5e-081051581063
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       +  NR++A++sR+R+ ++ie+L + +++ +a+  +L+ +++ +k   a l++e+
  Thecc1EG021629t1 105 LLANRVSAQKSRLRRMEYIEKLNKDIETEQAKIAELAPQVSYYKHRRAMLQKEN 158
                       567*****************************9999999999999999888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-499160IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.73E-8102152No hitNo description
CDDcd147033.03E-13103152No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-8105155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MPPKDQTSPN PEQMISPEGS NPPSSLDIVE LTSSLQATEP RRAISLHKRS ASDSLVILRK  60
PYLVGQSSSS LVTETQKWGR SFEPTMDPKK MKRWTYLHTH TMKLLLANRV SAQKSRLRRM  120
EYIEKLNKDI ETEQAKIAEL APQVSYYKHR RAMLQKENDE IKQKIEFLEK EEARKEAEYQ  180
ALKDERDMLA LTYFLQQEGL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026617.11e-146Uncharacterized protein TCM_021629
TrEMBLA0A061EXY51e-146A0A061EXY5_THECC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1865168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-17bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]